Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SHP/NR0B2/Nuclear Receptor SHP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15281620UL
Description
SHP/NR0B2/Nuclear Receptor SHP Polyclonal specifically detects SHP/NR0B2/Nuclear Receptor SHP in Human samples. It is validated for Western Blot.Specifications
| SHP/NR0B2/Nuclear Receptor SHP | |
| Polyclonal | |
| Western Blot 1:100-1:2000 | |
| Q15466 | |
| NR0B2 | |
| Synthetic peptides corresponding to NR0B2(nuclear receptor subfamily 0, group B, member 2) The peptide sequence was selected from the N terminal of NR0B2. Peptide sequence STSQPGACPCQGAASRPAILYALLSSSLKAVPRPRSRCLCRQHRPVQLCA. | |
| 20 μL | |
| GPCR | |
| 8431 | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| FLJ17090, nuclear receptor subfamily 0 group B member 2, nuclear receptor subfamily 0, group B, member 2, Orphan nuclear receptor SHP, SHPSHP1, Small heterodimer partner | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction