Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SHP/NR0B2/Nuclear Receptor SHP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | SHP/NR0B2/Nuclear Receptor SHP |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP152816
|
Novus Biologicals
NBP152816 |
100 μL |
Each for $487.50
|
|
|||||
|
NBP15281620
|
Novus Biologicals
NBP15281620UL |
20 μL | N/A | N/A | N/A | ||||
Description
SHP/NR0B2/Nuclear Receptor SHP Polyclonal specifically detects SHP/NR0B2/Nuclear Receptor SHP in Human samples. It is validated for Western Blot.Specifications
| SHP/NR0B2/Nuclear Receptor SHP | |
| Polyclonal | |
| Rabbit | |
| GPCR | |
| FLJ17090, nuclear receptor subfamily 0 group B member 2, nuclear receptor subfamily 0, group B, member 2, Orphan nuclear receptor SHP, SHPSHP1, Small heterodimer partner | |
| NR0B2 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q15466 | |
| 8431 | |
| Synthetic peptides corresponding to NR0B2(nuclear receptor subfamily 0, group B, member 2) The peptide sequence was selected from the N terminal of NR0B2. Peptide sequence STSQPGACPCQGAASRPAILYALLSSSLKAVPRPRSRCLCRQHRPVQLCA. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title