Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Siglec-3/CD33 Antibody, Novus Biologicals™

Siglec-3/CD33 Antibody, Novus Biologicals™
SDP

Catalog No. NBP232709 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP232709 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP232709 Supplier Novus Biologicals Supplier No. NBP232709
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Siglec-3/CD33 Polyclonal specifically detects Siglec-3/CD33 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Siglec-3/CD33
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias CD33 antigen, CD33 antigen (gp67), CD33 molecule, FLJ00391, myeloid cell surface antigen CD33, p67, sialic acid binding Ig-like lectin 3, Sialic acid-binding Ig-like lectin 3, SIGLEC-3, SIGLEC3gp67
Gene Symbols CD33
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: KTHRRKAARTAVGRNDTHPTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNPSKDTSTEYSEVRTQ
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Immunology
Primary or Secondary Primary
Gene ID (Entrez) 945
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.