Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
                
Learn More
Learn More
                                    Siglec-5/CD170 Antibody, Novus Biologicals™
 
                                    
                                    
                                    
                                    
                                
                            
                            
                            
                            
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19114925UL
Description
Siglec-5/CD170 Polyclonal specifically detects Siglec-5/CD170 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Siglec-5/CD170 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20-1:50 | |
| CD170, CD170 antigen, CD33 antigen-like 2, CD33L2OB binding protein-2, OB-BP2OB-binding protein 2, OBBP2sialic acid-binding Ig-like lectin 5, Obesity-binding protein 2, sialic acid binding Ig-like lectin 5, sialic acid-binding immunoglobulin-like lectin 5, SIGLEC-5 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | 
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| SIGLEC5 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:KARRKQAAGRPEKMDDEDPIMGTITSGSRKKPWPDSAGDQASPPGDAPPLEEQKELHYASLSFSEMKSREPKDQEAPSTTEYSEIKTSK | |
| 25 μL | |
| Immunology | |
| 8778 | |
| Human | |
| IgG | 
                    Product Content Correction
                
                Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
			
            For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
             
                            