Siglec-5/CD170 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB430060	Novus Biologicals NBP19114925UL	25 μL
NBP191149	Novus Biologicals NBP191149	0.1 mL

Description

Siglec-5/CD170 Polyclonal specifically detects Siglec-5/CD170 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Siglec-5/CD170
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: CD170, CD170 antigen, CD33 antigen-like 2, CD33L2OB binding protein-2, OB-BP2OB-binding protein 2, OBBP2sialic acid-binding Ig-like lectin 5, Obesity-binding protein 2, sialic acid binding Ig-like lectin 5, sialic acid-binding immunoglobulin-like lectin 5, SIGLEC-5
• Gene Symbols: SIGLEC5
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20-1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Immunology
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 8778
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:KARRKQAAGRPEKMDDEDPIMGTITSGSRKKPWPDSAGDQASPPGDAPPLEEQKELHYASLSFSEMKSREPKDQEAPSTTEYSEIKTSK
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only