Siglec-7/CD328 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159244

Catalog No. NBP159244

Description

Siglec-7/CD328 Polyclonal specifically detects Siglec-7/CD328 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Siglec-7/CD328
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Adhesion inhibitory receptor molecule 1, adhesion inhibitory receptor molecule 1, siglec-7, AIRM-1, AIRM1QA79 membrane protein, CD328, CD328 antigen, CDw328, D-siglec, p75, p75/AIRM1, QA79, sialic acid binding Ig-like lectin 7, sialic acid binding immunoglobulin-like lectin 7, sialic acid-binding Ig-like lectin 7, Siglec-7
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Bovine: 84%; Chimpanzee: 84%; Human: 100%;.
• Target Species: Human, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9Y286
• Gene Symbols: SIGLEC7
• Immunogen: Synthetic peptides corresponding to SIGLEC7(sialic acid binding Ig-like lectin 7) The peptide sequence was selected from the middle region of SIGLEC7. Peptide sequence WRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSLQQ.
• Quantity: 100 μL
• Research Discipline: Cardiovascular Biology
• Gene ID (Entrez): 27036
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.