Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Siglec-7/CD328 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Siglec-7/CD328 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Siglec-7/CD328 Polyclonal specifically detects Siglec-7/CD328 in Human samples. It is validated for Western Blot.Specifications
Siglec-7/CD328 | |
Polyclonal | |
Rabbit | |
Q9Y286 | |
27036 | |
Synthetic peptides corresponding to SIGLEC7(sialic acid binding Ig-like lectin 7) The peptide sequence was selected from the middle region of SIGLEC7. Peptide sequence WRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSLQQ. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Adhesion inhibitory receptor molecule 1, adhesion inhibitory receptor molecule 1, siglec-7, AIRM-1, AIRM1QA79 membrane protein, CD328, CD328 antigen, CDw328, D-siglec, p75, p75/AIRM1, QA79, sialic acid binding Ig-like lectin 7, sialic acid binding immunoglobulin-like lectin 7, sialic acid-binding Ig-like lectin 7, Siglec-7 | |
SIGLEC7 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title