Sigma-1 R/OPRS1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP182479

Catalog No. NBP182479

Description

Sigma-1 R/OPRS1 Polyclonal antibody specifically detects Sigma-1 R/OPRS1 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).

Specifications

• Antigen: Sigma-1 R/OPRS1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SIGMAR1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:FVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGG
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.1mg/mL
• Dilution: Western Blot 0.4 ug/ml, Simple Western 1:20, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:10-1:20
• Gene Alias: Aging-associated gene 8 protein, FLJ25585, hSigmaR1, OPRS1, SIG-1R, sigma 1, Sigma 1-type opioid receptor, sigma non-opioid intracellular receptor 1, sigma1 receptor, sigma1R, sigma1-receptor, SR31747 binding protein 1, SR31747-binding protein, SR-BP, SR-BP1, SRBPMGC3851, type I sigma receptor
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10280
• Target Species: Human, Rat
• Isotype: IgG

For Research Use Only