Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Sigma-1 R/OPRS1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$416.50 - $670.00
Specifications
Antigen | Sigma-1 R/OPRS1 |
---|---|
Concentration | 0.1mg/mL |
Dilution | Western Blot 0.4 ug/ml, Simple Western 1:20, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:10-1:20 |
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Description
Sigma-1 R/OPRS1 Polyclonal antibody specifically detects Sigma-1 R/OPRS1 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).Specifications
Sigma-1 R/OPRS1 | |
Western Blot 0.4 ug/ml, Simple Western 1:20, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:10-1:20 | |
Polyclonal | |
Rabbit | |
Human, Rat | |
Aging-associated gene 8 protein, FLJ25585, hSigmaR1, OPRS1, SIG-1R, sigma 1, Sigma 1-type opioid receptor, sigma non-opioid intracellular receptor 1, sigma1 receptor, sigma1R, sigma1-receptor, SR31747 binding protein 1, SR31747-binding protein, SR-BP, SR-BP1, SRBPMGC3851, type I sigma receptor | |
SIGMAR1 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
0.1mg/mL | |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
10280 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:FVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGG | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title