Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Signal Peptide Peptidase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier: Novus Biologicals NBP17411120UL

View more versions of this product

Catalog No. NB17419520

$206.00 / Each of 1

Already have an account? Sign In to view your price. New here? Register with us today!

Qty

Add to Cart

Description

Signal Peptide Peptidase Polyclonal specifically detects Signal Peptide Peptidase in Mouse samples. It is validated for Western Blot.

Specifications

Antigen	Signal Peptide Peptidase
Classification	Polyclonal
Dilution	Western Blot 1:100-1:2000
Gene Accession No.	Q9D8V0
Gene Symbols	HM13
Immunogen	Synthetic peptides corresponding to the middle region of H13. Immunizing peptide sequence IKLVFPQDLLEKGLEADNFAMLGLGDIVIPGIFIALLLRFDISLKKNTHT.
Quantity	20 μL
Primary or Secondary	Primary
Target Species	Mouse
Isotype	IgG

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias	dJ324O17.1, EC 3.4.23.-, H13hIMP1, histocompatibility (minor) 13, IMP-1, IMP1MSTP086, Intramembrane protease 1, minor histocompatibility antigen 13, minor histocompatibility antigen H13, Presenilin-like protein 3, PSENL3, PSL3IMPAS, Signal peptide peptidase, signal peptide peptidase beta, SPPIMPAS-1
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Gene ID (Entrez)	81502
Content And Storage	Store at -20C. Avoid freeze-thaw cycles.

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Spot an opportunity for improvement?Share a Content Correction

Signal Peptide Peptidase Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions