Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Signal Peptide Peptidase Antibody, Novus Biologicals™
SDP

Catalog No. NB17419520 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB17419520 20 μL
NBP174111 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB17419520 Supplier Novus Biologicals Supplier No. NBP17411120UL

Rabbit Polyclonal Antibody

Signal Peptide Peptidase Polyclonal specifically detects Signal Peptide Peptidase in Mouse samples. It is validated for Western Blot.

Specifications

Antigen Signal Peptide Peptidase
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9D8V0
Gene Alias dJ324O17.1, EC 3.4.23.-, H13hIMP1, histocompatibility (minor) 13, IMP-1, IMP1MSTP086, Intramembrane protease 1, minor histocompatibility antigen 13, minor histocompatibility antigen H13, Presenilin-like protein 3, PSENL3, PSL3IMPAS, Signal peptide peptidase, signal peptide peptidase beta, SPPIMPAS-1
Gene Symbols HM13
Host Species Rabbit
Immunogen Synthetic peptides corresponding to the middle region of H13. Immunizing peptide sequence IKLVFPQDLLEKGLEADNFAMLGLGDIVIPGIFIALLLRFDISLKKNTHT.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 81502
Target Species Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.