Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Signal Peptide Peptidase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | Signal Peptide Peptidase |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB17419520
|
Novus Biologicals
NBP17411120UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP174111
|
Novus Biologicals
NBP174111 |
100 μL |
Each for $487.50
|
|
|||||
Description
Signal Peptide Peptidase Polyclonal specifically detects Signal Peptide Peptidase in Mouse samples. It is validated for Western Blot.Specifications
| Signal Peptide Peptidase | |
| Polyclonal | |
| Rabbit | |
| Q9D8V0 | |
| 81502 | |
| Synthetic peptides corresponding to the middle region of H13. Immunizing peptide sequence IKLVFPQDLLEKGLEADNFAMLGLGDIVIPGIFIALLLRFDISLKKNTHT. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| dJ324O17.1, EC 3.4.23.-, H13hIMP1, histocompatibility (minor) 13, IMP-1, IMP1MSTP086, Intramembrane protease 1, minor histocompatibility antigen 13, minor histocompatibility antigen H13, Presenilin-like protein 3, PSENL3, PSL3IMPAS, Signal peptide peptidase, signal peptide peptidase beta, SPPIMPAS-1 | |
| HM13 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title