Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Signal peptide peptidase-like 2B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25507325UL
Description
Signal peptide peptidase-like 2B Polyclonal specifically detects Signal peptide peptidase-like 2B in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
Signal peptide peptidase-like 2B | |
Polyclonal | |
Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL | |
EC 3.4.23, EC 3.4.23.-, IMP-4, IMP4MGC111084, Intramembrane protease 4, KIAA1532signal peptide peptidase-like 2B, Presenilin-like protein 1, PSL1, SNPPL2B, SPPL2b, SPP-like 2B | |
Rabbit | |
Affinity Purified | |
RUO | |
56928 | |
Human | |
IgG |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
SPPL2B | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YWAGSRDVKKRYMKHKRDDGPEKQEDEAVDV | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction