Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Signal peptide peptidase-like 2B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Signal peptide peptidase-like 2B |
---|---|
Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Signal peptide peptidase-like 2B Polyclonal specifically detects Signal peptide peptidase-like 2B in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
Signal peptide peptidase-like 2B | |
Polyclonal | |
Rabbit | |
Human | |
EC 3.4.23, EC 3.4.23.-, IMP-4, IMP4MGC111084, Intramembrane protease 4, KIAA1532signal peptide peptidase-like 2B, Presenilin-like protein 1, PSL1, SNPPL2B, SPPL2b, SPP-like 2B | |
SPPL2B | |
IgG | |
Affinity Purified |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
56928 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YWAGSRDVKKRYMKHKRDDGPEKQEDEAVDV | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title