SIN3B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180222

Catalog No. NBP180222

Description

SIN3B Polyclonal specifically detects SIN3B in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: SIN3B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Histone deacetylase complex subunit Sin3b, KIAA0700paired amphipathic helix protein Sin3b, SIN3 homolog B, transcription regulator (yeast), SIN3 homolog B, transcriptional regulator, SIN3 homolog B, transcriptional regulator (yeast), Transcriptional corepressor Sin3b
• Host Species: Rabbit
• Molecular Weight of Antigen: 105 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Dog: 86%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_033214
• Gene Symbols: SIN3B
• Immunogen: Synthetic peptide directed towards the N terminal of human SIN3B. Peptide sequence NIQSPLSSQDNSHSHGDCGEDFKQMSYKEDRGQVPLESDSVEFNNAISYV.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23309
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG