Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SIN3B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP180222
Description
SIN3B Polyclonal specifically detects SIN3B in Mouse samples. It is validated for Western Blot.Specifications
SIN3B | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
Histone deacetylase complex subunit Sin3b, KIAA0700paired amphipathic helix protein Sin3b, SIN3 homolog B, transcription regulator (yeast), SIN3 homolog B, transcriptional regulator, SIN3 homolog B, transcriptional regulator (yeast), Transcriptional corepressor Sin3b | |
Rabbit | |
105 kDa | |
100 μL | |
Primary | |
Dog: 86%. | |
Human, Mouse, Rat, Pig, Bovine, Canine, Equine | |
Purified |
Western Blot | |
1 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_033214 | |
SIN3B | |
Synthetic peptide directed towards the N terminal of human SIN3B. Peptide sequence NIQSPLSSQDNSHSHGDCGEDFKQMSYKEDRGQVPLESDSVEFNNAISYV. | |
Protein A purified | |
RUO | |
23309 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction