SKAR Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157411

Catalog No. NBP157411

Description

SKAR Polyclonal specifically detects SKAR in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SKAR
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: KIAA1649polymerase delta interacting protein 46, p46, PDIP46S6K1 Aly/REF-like target, polymerase (DNA-directed), delta interacting protein 3, RNA-binding protein P46, SKARpolymerase delta-interacting protein 3,46 kDa DNA polymerase delta interaction protein
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84271
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q9BY77
• Gene Symbols: POLDIP3
• Immunogen: Synthetic peptides corresponding to POLDIP3(polymerase (DNA-directed), delta interacting protein 3) The peptide sequence was selected from the C terminal of POLDIP3. Peptide sequence DAITAYKKYNNRCLDGQPMKCNLHMNGNVITSDQPILLRLSDSPSMKKES.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Chicken: 92%; Xenopus: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG