Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SKAR Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | SKAR |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SKAR Polyclonal specifically detects SKAR in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
SKAR | |
Polyclonal | |
Rabbit | |
Q9BY77 | |
84271 | |
Synthetic peptides corresponding to POLDIP3(polymerase (DNA-directed), delta interacting protein 3) The peptide sequence was selected from the C terminal of POLDIP3. Peptide sequence DAITAYKKYNNRCLDGQPMKCNLHMNGNVITSDQPILLRLSDSPSMKKES. | |
Primary |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
KIAA1649polymerase delta interacting protein 46, p46, PDIP46S6K1 Aly/REF-like target, polymerase (DNA-directed), delta interacting protein 3, RNA-binding protein P46, SKARpolymerase delta-interacting protein 3,46 kDa DNA polymerase delta interaction protein | |
POLDIP3 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title