Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SKIV2L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP24727525UL
Description
SKIV2L Polyclonal specifically detects SKIV2L in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
SKIV2L | |
Polyclonal | |
Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
170A, DDX13helicase SKI2W, EC 3.6.1, Helicase-like protein, HLPEC 3.6.4.-, SKI2, SKI2Wsuperkiller viralicidic activity 2 (S. cerevisiae homolog)-like, SKIV2, superkiller viralicidic activity 2-like (S. cerevisiae), W | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
SKIV2L | |
This antibody was developed against a recombinant protein corresponding to amino acids: TGNSSKTQGELFLLLDSRGAFHTKGYYAAVEAKKERMSKHAQTFGAKQPTHQGGPAQDRGVYLSLLASLRTRAQLPVVV | |
25 μL | |
Lipid and Metabolism, Unfolded Protein Response, Vision | |
6499 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction