Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SKIV2L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | SKIV2L |
---|---|
Dilution | Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
SKIV2L Polyclonal specifically detects SKIV2L in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
SKIV2L | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
170A, DDX13helicase SKI2W, EC 3.6.1, Helicase-like protein, HLPEC 3.6.4.-, SKI2, SKI2Wsuperkiller viralicidic activity 2 (S. cerevisiae homolog)-like, SKIV2, superkiller viralicidic activity 2-like (S. cerevisiae), W | |
SKIV2L | |
IgG | |
Affinity Purified |
Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
Polyclonal | |
Rabbit | |
Lipid and Metabolism, Unfolded Protein Response, Vision | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
6499 | |
This antibody was developed against a recombinant protein corresponding to amino acids: TGNSSKTQGELFLLLDSRGAFHTKGYYAAVEAKKERMSKHAQTFGAKQPTHQGGPAQDRGVYLSLLASLRTRAQLPVVV | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title