SLC10A5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159707

Catalog No. NBP159707

Description

SLC10A5 Polyclonal specifically detects SLC10A5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SLC10A5
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Na(+)/bile acid cotransporter 5, P5, sodium/bile acid cotransporter 5, solute carrier family 10 (sodium/bile acid cotransporter family), member 5, Solute carrier family 10 member 5
• Host Species: Rabbit
• Molecular Weight of Antigen: 48 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Porcine 79%.
• Target Species: Human, Rat, Pig, Equine
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q5PT55
• Gene Symbols: SLC10A5
• Immunogen: Synthetic peptides corresponding to SLC10A5(solute carrier family 10 (sodium/bile acid cotransporter family), member 5) The peptide sequence was selected from the C terminal of SLC10A5. Peptide sequence GYSFAKVCTLPLPVCKTVAIESGMLNSFLALAVIQLSFPQSKANLASVAP The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 347051
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG