Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC10A7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP159875
Description
SLC10A7 Polyclonal specifically detects SLC10A7 in Human samples. It is validated for Western Blot.Specifications
SLC10A7 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
C4orf13, chromosome 4 open reading frame 13, DKFZp313H0531, DKFZp566M114, DKFZp779O2438, MGC25043, Na(+)/bile acid cotransporter 7, P7, SBF-domain containing protein, sodium/bile acid cotransporter 7, solute carrier family 10 (sodium/bile acid cotransporter family), member 7, Solute carrier family 10 member 7 | |
Rabbit | |
Affinity purified | |
RUO | |
84068 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q0GE19-2 | |
SLC10A7 | |
Synthetic peptides corresponding to SLC10A7(solute carrier family 10 (sodium/bile acid cotransporter family), member 7). The peptide sequence was selected from the middle region of SLC10A7. Peptide sequence: TTFCDTFSNPNIDLDKFSLVLILFIIFSIQLSFMLLTFIFSTRNNSGFTP | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Canine: 100%; Equine: 100%; Rat: 100%; Chicken: 92%; Pig: 92%. | |
Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction