SLC12A3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159699

Catalog No. NBP159699

Description

SLC12A3 Polyclonal specifically detects SLC12A3 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: SLC12A3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ96318, Na-Cl symporter, NCCT, solute carrier family 12 (sodium/chloride transporters), member 3, solute carrier family 12 member 3, thiazide-sensitive Na-Cl cotransporter, Thiazide-sensitive sodium-chloride cotransporter, TSCNaCl electroneutral thiazide-sensitive cotransporter
• Host Species: Rabbit
• Molecular Weight of Antigen: 114 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunocytochemistry/Immunofluorescence
• Gene Accession No.: P55017-2
• Gene Symbols: SLC12A3
• Immunogen: Synthetic peptides corresponding to SLC12A3(solute carrier family 12 (sodium/chloride transporters), member 3) The peptide sequence was selected from the middle region of SLC12A3. Peptide sequence ALIVITLPIGRKGKCPSSLYMAWLETLSQDLRPPVILIRGNQENVLTFYC The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6559
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

For Research Use Only