Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLC12A3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP159699 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159699 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP159699 Supplier Novus Biologicals Supplier No. NBP159699
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

SLC12A3 Polyclonal specifically detects SLC12A3 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

Antigen SLC12A3
Applications Western Blot, Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunocytochemistry/Immunofluorescence
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P55017-2
Gene Alias FLJ96318, Na-Cl symporter, NCCT, solute carrier family 12 (sodium/chloride transporters), member 3, solute carrier family 12 member 3, thiazide-sensitive Na-Cl cotransporter, Thiazide-sensitive sodium-chloride cotransporter, TSCNaCl electroneutral thiazide-sensitive cotransporter
Gene Symbols SLC12A3
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SLC12A3(solute carrier family 12 (sodium/chloride transporters), member 3) The peptide sequence was selected from the middle region of SLC12A3. Peptide sequence ALIVITLPIGRKGKCPSSLYMAWLETLSQDLRPPVILIRGNQENVLTFYC The peptide sequence for this immunogen was taken from within the described region.
Molecular Weight of Antigen 114 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6559
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.