Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLC13A2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP162518 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP162518 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP162518 Supplier Novus Biologicals Supplier No. NBP162518
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

SLC13A2 Polyclonal specifically detects SLC13A2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen SLC13A2
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q13183
Gene Alias Na(+)/dicarboxylate cotransporter 1, NADC1Na(+)-coupled citrate transporter, NaDC-1NaCT, Renal sodium/dicarboxylate cotransporter, SDCT1, solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2, solute carrier family 13 member 2
Gene Symbols SLC13A2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SLC13A2(solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2) The peptide sequence was selected from the middle region of SLC13A2. Peptide sequence PNAKGESMVSDGTVAIFIGIIMFIIPSKFPGLTQDPENPGKLKAPLGLLD The peptide sequence for this immunogen was taken from within the described region.
Molecular Weight of Antigen 64 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9058
Test Specificity Expected identity based on immunogen sequence: Canine: 77%; Rabbit: 85%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Rat, Pig, Bovine, Canine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.