Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLC14A1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP160115 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP160115 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP160115 Supplier Novus Biologicals Supplier No. NBP160115
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

SLC14A1 Polyclonal specifically detects SLC14A1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen SLC14A1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q13336
Gene Alias FLJ33745, HsT1341, HUT11, JKFLJ41687, RACH1, solute carrier family 14 (urea transporter), member 1 (Kidd blood group), Solute carrier family 14 member 1, truncated urea transporter, urea transporter 1, urea transporter JK glycoprotein, Urea transporter, erythrocyte, urea transporter-B1, UT1UT-B1, UTEblood group Kidd urea transporter
Gene Symbols SLC14A1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SLC14A1(solute carrier family 14 (urea transporter), member 1 (Kidd blood group)) The peptide sequence was selected from the C terminal of SLC14A1. Peptide sequence LSSPLMCLHAAIGSLLGIAAGLSLSAPFENIYFGLWGFNSSLACIAMGGM The peptide sequence for this immunogen was taken from within the described region.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6563
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Pig, Bovine, Canine, Equine, Goat, Sheep
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.