Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC15A4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15963720UL
Description
SLC15A4 Polyclonal specifically detects SLC15A4 in Human samples. It is validated for Western Blot.Specifications
SLC15A4 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
Q8N697 | |
SLC15A4 | |
Synthetic peptides corresponding to SLC15A4(solute carrier family 15, member 4) The peptide sequence was selected from the middle region of SLC15A4 (NP_663623). Peptide sequence GLLPSSLKRIAVGMFFVMCSAFAAGILESKRLNLVKEKTINQTIGNVVYH. | |
Affinity Purified | |
RUO | |
121260 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Peptide transporter 4, Peptide/histidine transporter 1, PHT1hPHT1, PTR4peptide-histidine transporter 4, solute carrier family 15 member 4, solute carrier family 15, member 4 | |
Rabbit | |
62 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction