Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC15A4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$532.07
Specifications
| Antigen | SLC15A4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP159637
![]() |
Novus Biologicals
NBP159637 |
100 μL |
Each for $532.07
|
|
|||||
NBP15963720
![]() |
Novus Biologicals
NBP15963720UL |
20 μL | N/A | N/A | N/A | ||||
Description
SLC15A4 Polyclonal specifically detects SLC15A4 in Human samples. It is validated for Western Blot.Specifications
| SLC15A4 | |
| Polyclonal | |
| Rabbit | |
| Q8N697 | |
| 121260 | |
| Synthetic peptides corresponding to SLC15A4(solute carrier family 15, member 4) The peptide sequence was selected from the middle region of SLC15A4 (NP_663623). Peptide sequence GLLPSSLKRIAVGMFFVMCSAFAAGILESKRLNLVKEKTINQTIGNVVYH. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Peptide transporter 4, Peptide/histidine transporter 1, PHT1hPHT1, PTR4peptide-histidine transporter 4, solute carrier family 15 member 4, solute carrier family 15, member 4 | |
| SLC15A4 | |
| IgG | |
| 62 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title