Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC15A4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
Antigen | SLC15A4 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15963720
|
Novus Biologicals
NBP15963720UL |
20 μL |
Each for $204.00
|
|
|||||
NBP159637
|
Novus Biologicals
NBP159637 |
100 μL |
Each for $482.50
|
|
|||||
Description
SLC15A4 Polyclonal specifically detects SLC15A4 in Human samples. It is validated for Western Blot.Specifications
SLC15A4 | |
Polyclonal | |
Rabbit | |
Q8N697 | |
121260 | |
Synthetic peptides corresponding to SLC15A4(solute carrier family 15, member 4) The peptide sequence was selected from the middle region of SLC15A4 (NP_663623). Peptide sequence GLLPSSLKRIAVGMFFVMCSAFAAGILESKRLNLVKEKTINQTIGNVVYH. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Peptide transporter 4, Peptide/histidine transporter 1, PHT1hPHT1, PTR4peptide-histidine transporter 4, solute carrier family 15 member 4, solute carrier family 15, member 4 | |
SLC15A4 | |
IgG | |
62 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title