Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC16A12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP159530
Description
SLC16A12 Polyclonal specifically detects SLC16A12 in Human samples. It is validated for Western Blot.Specifications
SLC16A12 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
CJMG, DKFZp686E188, MCT 12, MCT12monocarboxylate transporter 12, solute carrier family 16 (monocarboxylic acid transporters), member 12, Solute carrier family 16 member 12, solute carrier family 16, member 12 (monocarboxylic acid transporter 12) | |
Rabbit | |
Affinity purified | |
RUO | |
387700 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q6ZSM3 | |
SLC16A12 | |
Synthetic peptides corresponding to SLC16A12(solute carrier family 16, member 12 (monocarboxylic acid transporter 12)) The peptide sequence was selected from the N terminal of SLC16A12. Peptide sequence WMIVAGCFLVTICTRAVTRCISIFFVEFQTYFTQDYAQTAWIHSIVDCVT The peptide sequence for this immunogen was taken from within the described region. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Equine: 100%; Human: 100%; Bovine: 92%; Canine: 92%; Guinea pig: 92%; Pig: 92%; Rabbit: 92%; Rat: 85%; Chicken: 78%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction