Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC16A12 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$149.00 - $329.00
Specifications
| Antigen | SLC16A12 |
|---|---|
| Immunogen | Synthetic peptides corresponding to SLC16A12(solute carrier family 16, member 12 (monocarboxylic acid transporter 12)) The peptide sequence was selected from the N terminal of SLC16A12. Peptide sequence WMIVAGCFLVTICTRAVTRCISIFFVEFQTYFTQDY |
| Host Species | Rabbit |
| Primary or Secondary | Primary |
| Monoclonal or Polyclonal | Polyclonal |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
| NBP15953020 |
Novus Biologicals
NBP15953020UL |
20ul |
Each for $149.00
|
|
NBP159530 |
Novus Biologicals
NBP159530 |
100 ul |
Each for $329.00
|
|
Description
SLC16A12 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.Specifications
| SLC16A12 | |
| Rabbit | |
| Polyclonal | |
| Unconjugated | |
| 387700 | |
| Affinity Purified | |
| Western Blot | |
| RUO |
| Synthetic peptides corresponding to SLC16A12(solute carrier family 16, member 12 (monocarboxylic acid transporter 12)) The peptide sequence was selected from the N terminal of SLC16A12. Peptide sequence WMIVAGCFLVTICTRAVTRCISIFFVEFQTYFTQDY | |
| Primary | |
| IgG | |
| CJMG, DKFZp686E188, MCT 12, MCT12monocarboxylate transporter 12, solute carrier family 16 (monocarboxylic acid transporters), member 12, Solute carrier family 16 member 12, solute carrier family 16, member 12 (monocarboxylic acid transporter 12) | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Immunogen affinity purified | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title