SLC1A4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP27652825UL

Catalog No. NB402750

Description

SLC1A4 Polyclonal specifically detects SLC1A4 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: SLC1A4
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
• Gene Alias: Alanine/serine/cysteine/threonine transporter 1, ASCT1, ASCT1 ASCT-1, neutral amino acid transporter A, SATTglutamate/neutral amino acid transporter, solute carrier family 1 (glutamate/neutral amino acid transporter), member 4, Solute carrier family 1 member 4
• Host Species: Rabbit
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
• Gene Symbols: SLC1A4
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KPGSGAQTLQSSDLGLEDSGPPPVPKETVDSFLDLA
• Regulatory Status: RUO
• Gene ID (Entrez): 6509
• Target Species: Human
• Form: Purified