SLC1A5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18932825UL

Catalog No. NB430765

Description

SLC1A5 Polyclonal specifically detects SLC1A5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SLC1A5
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200
• Gene Alias: AAAT, ASCT2M7VS1, ATB(0), Baboon M7 virus receptor, M7V1ATBO, neutral amino acid transporter B, neutral amino acid transporter B(0), R16, RD114 virus receptor, RD114/simian type D retrovirus receptor, RDR, RDRCFLJ31068, Sodium-dependent neutral amino acid transporter type 2, solute carrier family 1 (neutral amino acid transporter), member 5, Solute carrier family 1 member 5
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6510
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SLC1A5
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MVADPPRDSKGLAAAEPTANGGLALASIEDQGAAAGGYCGSRDQVRRCLRAN
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only