SLC1A5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB430765	Novus Biologicals NBP18932825UL	25 μL
NBP189328	Novus Biologicals NBP189328	0.1 mL

Description

SLC1A5 Polyclonal specifically detects SLC1A5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SLC1A5
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 6510
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MVADPPRDSKGLAAAEPTANGGLALASIEDQGAAAGGYCGSRDQVRRCLRAN
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: AAAT, ASCT2M7VS1, ATB(0), Baboon M7 virus receptor, M7V1ATBO, neutral amino acid transporter B, neutral amino acid transporter B(0), R16, RD114 virus receptor, RD114/simian type D retrovirus receptor, RDR, RDRCFLJ31068, Sodium-dependent neutral amino acid transporter type 2, solute carrier family 1 (neutral amino acid transporter), member 5, Solute carrier family 1 member 5
• Gene Symbols: SLC1A5
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only