Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP159732

SLC1A5 Antibody, Novus Biologicals™
SDP

Catalog No. NBP159732 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159732 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP159732 Supplier Novus Biologicals Supplier No. NBP159732
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

SLC1A5 Polyclonal antibody specifically detects SLC1A5 in Human, Bovine samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).

Specifications

Antigen SLC1A5
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 4-8 ug/ml, Immunohistochemistry-Paraffin 4-8 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q71UA6
Gene Alias AAAT, ASCT2M7VS1, ATB(0), Baboon M7 virus receptor, M7V1ATBO, neutral amino acid transporter B, neutral amino acid transporter B(0), R16, RD114 virus receptor, RD114/simian type D retrovirus receptor, RDR, RDRCFLJ31068, Sodium-dependent neutral amino acid transporter type 2, solute carrier family 1 (neutral amino acid transporter), member 5, Solute carrier family 1 member 5
Gene Symbols SLC1A5
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SLC1A5(solute carrier family 1 (neutral amino acid transporter), member 5) The peptide sequence was selected from the middle region of SLC1A5 (NP_005619). Peptide sequence FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV The peptide sequence for this immunogen was taken from within the described region.
Molecular Weight of Antigen 60 kDa
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6510
Test Specificity Zebrafish 86%.
Reconstitution Reconstitute in 100μL distilled water to a final antibody concentration of 1mg/mL.
Target Species Human, Bovine, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.