Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP16252620

SLC22A12 Antibody, Novus Biologicals™
SDP

Catalog No. NBP16252620 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16252620 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP16252620 Supplier Novus Biologicals Supplier No. NBP16252620UL

Description

Rabbit Polyclonal Antibody

SLC22A12 Polyclonal specifically detects SLC22A12 in Human samples. It is validated for Western Blot.

Specifications

Antigen SLC22A12
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q96S37
Gene Alias OATL4, Organic anion transporter 4-like protein, Renal-specific transporter, RSTmember 12, solute carrier family 22 (organic anion/urate transporter), member 12, URAT1, URAT1Urate anion exchanger 1, urate transporter 1
Gene Symbols SLC22A12
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SLC22A12(solute carrier family 22 (organic anion/urate transporter), member 12) The peptide sequence was selected form the N terminal of SLC22A12. Peptide sequence SMLENFSAAVPSHRCWAPLLDNSTAQASILGSLSPEALLAISIPPGPNQR.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 116085
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.