SLC22A13 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP16252020UL

Catalog No. NBP16252020

Description

SLC22A13 Polyclonal specifically detects SLC22A13 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SLC22A13
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: Q9Y226
• Gene Symbols: SLC22A13
• Immunogen: Synthetic peptides corresponding to SLC22A13(solute carrier family 22, member 13) The peptide sequence was selected from the N terminal of SLC22A13. Peptide sequence FFAHVFMVLDEPHHCAVAWVKNHTFNLSAAEQLVLSVPLDTAGHPEPCLM.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9390
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: OAT10, OCTL1, OCTL3, ORCTL3, ORCTL-3, Organic cation transporter-like 3, organic cationic transporter-like 3, organic-cation transporter like 3, solute carrier family 22 (organic anion transporter), member 13, solute carrier family 22 member 13, solute carrier family 22, member 13
• Host Species: Rabbit
• Molecular Weight of Antigen: 61 kDa
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG