Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLC22A13 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen SLC22A13
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP16252020
SDP
View Documents
Novus Biologicals
NBP16252020UL
20 μL
Each for $206.00
Only null left
Add to Cart
 
NBP162520
SDP
View Documents
Novus Biologicals
NBP162520
100 μL
Each for $487.50
Only null left
Add to Cart
 
Description

Description

SLC22A13 Polyclonal specifically detects SLC22A13 in Human samples. It is validated for Western Blot.
Specifications

Specifications

SLC22A13
Polyclonal
Rabbit
Q9Y226
9390
Synthetic peptides corresponding to SLC22A13(solute carrier family 22, member 13) The peptide sequence was selected from the N terminal of SLC22A13. Peptide sequence FFAHVFMVLDEPHHCAVAWVKNHTFNLSAAEQLVLSVPLDTAGHPEPCLM.
Primary
Western Blot
Unconjugated
RUO
OAT10, OCTL1, OCTL3, ORCTL3, ORCTL-3, Organic cation transporter-like 3, organic cationic transporter-like 3, organic-cation transporter like 3, solute carrier family 22 (organic anion transporter), member 13, solute carrier family 22 member 13, solute carrier family 22, member 13
SLC22A13
IgG
61 kDa
Videos
SDS
Documents

Documents

Product Certifications
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.