Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC22A13 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | SLC22A13 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP16252020
|
Novus Biologicals
NBP16252020UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP162520
|
Novus Biologicals
NBP162520 |
100 μL |
Each for $487.50
|
|
|||||
Description
SLC22A13 Polyclonal specifically detects SLC22A13 in Human samples. It is validated for Western Blot.Specifications
| SLC22A13 | |
| Polyclonal | |
| Rabbit | |
| Q9Y226 | |
| 9390 | |
| Synthetic peptides corresponding to SLC22A13(solute carrier family 22, member 13) The peptide sequence was selected from the N terminal of SLC22A13. Peptide sequence FFAHVFMVLDEPHHCAVAWVKNHTFNLSAAEQLVLSVPLDTAGHPEPCLM. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| OAT10, OCTL1, OCTL3, ORCTL3, ORCTL-3, Organic cation transporter-like 3, organic cationic transporter-like 3, organic-cation transporter like 3, solute carrier family 22 (organic anion transporter), member 13, solute carrier family 22 member 13, solute carrier family 22, member 13 | |
| SLC22A13 | |
| IgG | |
| 61 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title