Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC22A15 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | SLC22A15 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SLC22A15 Polyclonal specifically detects SLC22A15 in Human samples. It is validated for Western Blot.Specifications
SLC22A15 | |
Polyclonal | |
Rabbit | |
DKFZp761G0313, Flipt 1, FLIPT1PRO34686, fly-like putative organic ion transporter 1, Fly-like putative transporter 1, solute carrier family 22 (organic cation transporter), member 15, solute carrier family 22 member 15, solute carrier family 22, member 15, trans-like protein | |
SLC22A15 | |
IgG | |
59 kDa |
Western Blot | |
Unconjugated | |
RUO | |
55356 | |
Synthetic peptides corresponding to SLC22A15(solute carrier family 22, member 15) The peptide sequence was selected from the middle region of SLC22A15. Peptide sequence NQKWFGRKRTLSAFLCLGGLACLIVMFLPEKKDTGVFAVVNSHSLSLLGK. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title