Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLC22A2/OCT2 Antibody (CL0631), Novus Biologicals™

Mouse Monoclonal Antibody

Supplier: Novus Biologicals NBP25294225UL

View more versions of this product

Catalog No. NB395343

$382.00 / Each of 1

Already have an account? Sign In to view your price. New here? Register with us today!

Qty

Add to Cart

Description

SLC22A2/OCT2 Monoclonal antibody specifically detects SLC22A2/OCT2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen	SLC22A2/OCT2
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	PBS (pH 7.2), 40% Glycerol
Host Species	Mouse
Purification Method	Protein A purified
Regulatory Status	RUO
Gene ID (Entrez)	6582
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype	IgG2b

Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Clone	CL0631
Dilution	Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias	hOCT2, MGC32628, OCT2Organic cation transporter 2, solute carrier family 22 (organic cation transporter), member 2, solute carrier family 22 member 2
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: ESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIR
Quantity	25 μL
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Spot an opportunity for improvement?Share a Content Correction

SLC22A2/OCT2 Antibody (CL0631), Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions