Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC22A2/OCT2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications
Supplier: Novus Biologicals NBP189417
Description
SLC22A2/OCT2 Polyclonal specifically detects SLC22A2/OCT2 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Single Cell Western.Specifications
SLC22A2/OCT2 | |
Polyclonal | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
hOCT2, MGC32628, OCT2Organic cation transporter 2, solute carrier family 22 (organic cation transporter), member 2, solute carrier family 22 member 2 | |
Rabbit | |
63 kDa | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot | |
0.2mg/mL | |
Western Blot Reactivity reported in scientific literature (PMID: 26045896)., Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000, Single Cell Western Single Cell Western reported by an internal validation at a 1:20 dilution | |
O15244 | |
SLC22A2 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:ESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIR | |
Affinity Purified | |
RUO | |
6582 | |
Human, Rat | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction