SLC22A2/OCT2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Catalog Number	Mfr. No.	Quantity
NB430703	Novus Biologicals NBP18941725UL	25 μL
NBP189417	Novus Biologicals NBP189417	0.1 mL

Description

SLC22A2/OCT2 Polyclonal specifically detects SLC22A2/OCT2 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Single Cell Western.

Specifications

• Antigen: SLC22A2/OCT2
• Dilution: Western Blot Reactivity reported in scientific literature (PMID: 26045896)., Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000, Single Cell Western Single Cell Western reported by an internal validation at a 1:20 dilution
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human, Rat
• Gene Accession No.: O15244
• Gene ID (Entrez): 6582
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:ESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIR
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Molecular Weight of Antigen: 63 kDa

• Concentration: 0.2mg/mL
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: hOCT2, MGC32628, OCT2Organic cation transporter 2, solute carrier family 22 (organic cation transporter), member 2, solute carrier family 22 member 2
• Gene Symbols: SLC22A2
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only