Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP160107

SLC22A8 Antibody, Novus Biologicals™
SDP

Catalog No. NBP160107 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP160107 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP160107 Supplier Novus Biologicals Supplier No. NBP160107
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

SLC22A8 Polyclonal specifically detects SLC22A8 in Human samples. It is validated for Western Blot.

Specifications

Antigen SLC22A8
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8TCC7
Gene Alias hOAT3, MGC24086, OAT3Organic anion transporter 3, solute carrier family 22 (organic anion transporter), member 8, solute carrier family 22 member 8
Gene Symbols SLC22A8
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SLC22A8(solute carrier family 22 (organic anion transporter), member 8) The peptide sequence was selected from the middle region of SLC22A8. Peptide sequence PETLNQPLPETIEDLENWSLRAKKPKQEPEVEKASQRIPLQPHGPGLGSS The peptide sequence for this immunogen was taken from within the described region.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9376
Test Specificity Expected identity based on immunogen sequence: Human: 100%; Canine: 78%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Bovine, Canine, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.