Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SLC24A1 Antibody, Novus Biologicals™

SLC24A1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP162521 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP162521 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP162521 Supplier Novus Biologicals Supplier No. NBP162521
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

SLC24A1 Polyclonal specifically detects SLC24A1 in Human samples. It is validated for Western Blot.

Specifications

Antigen SLC24A1
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. O60721
Gene Alias HsT17412, KIAA0702Na(+)/K(+)/Ca(2+)-exchange protein 1, NCKX, NCKX1Retinal rod Na-Ca+K exchanger, retinal rod Na+/Ca+/K+ exchanger, RODX, sodium/potassium/calcium exchanger 1, solute carrier family 24 (sodium/potassium/calcium exchanger), member 1
Gene Symbols SLC24A1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SLC24A1(solute carrier family 24 (sodium/potassium/calcium exchanger), member 1) The peptide sequence was selected from the middle region of SLC24A1. Peptide sequence EQLSRRPVAKVMALEDLSKPGDGAIAVDELQDNKKLKLPSLLTRGSSSTS The peptide sequence for this immunogen was taken from within the described region.
Molecular Weight of Antigen 121 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9187
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Rat, Canine
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.