SLC24A4 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP159897	100 μL

Catalog No. NBP159897 Supplier Novus Biologicals Supplier No. NBP159897

Description

Rabbit Polyclonal Antibody

SLC24A4 Polyclonal specifically detects SLC24A4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SLC24A4
• Applications: Western Blot
• Classification: Polyclonal
• Concentration: 0.5 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: Q8NFF2
• Gene Alias: Na(+)/K(+)/Ca(2+)-exchange protein 4, NCKX4FLJ38852, SHEP6, SLC24A2, sodium/potassium/calcium exchanger 4, solute carrier family 24 (sodium/potassium/calcium exchanger), member 4, Solute carrier family 24 member 4
• Gene Symbols: SLC24A4
• Host Species: Rabbit
• Immunogen: Synthetic peptides corresponding to SLC24A4(solute carrier family 24 (sodium/potassium/calcium exchanger), member 4) The peptide sequence was selected from the N terminal of SLC24A4. Peptide sequence PSLEKICERLHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTI The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 123041
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%.
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only