Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLC25A19 Antibody, Novus Biologicals™
SDP

Catalog No. NBP18052820 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP18052820 20 μL
NBP180528 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP18052820 Supplier Novus Biologicals Supplier No. NBP18052820UL

Rabbit Polyclonal Antibody

SLC25A19 Polyclonal specifically detects SLC25A19 in Human samples. It is validated for Western Blot.

Specifications

Antigen SLC25A19
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_068380
Gene Alias DNC, MCPHA, mitochondrial thiamine pyrophosphate carrier, mitochondrial uncoupling protein 1, MUP1, solute carrier family 25 (mitochondrial deoxynucleotide carrier), member 19, solute carrier family 25 (mitochondrial thiamine pyrophosphate carrier), member 19, TPC
Gene Symbols SLC25A19
Host Species Rabbit
Immunogen Synthetic peptide directed towards the middle region of human SLC25A19. Peptide sequence VHRGSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQGEPKVYN.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 60386
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.