Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC25A20 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
Supplier: Novus Biologicals NBP18669025UL
Description
SLC25A20 Polyclonal specifically detects SLC25A20 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
SLC25A20 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
CACCarnitine/acylcarnitine translocase, CACTSolute carrier family 25 member 20, mitochondrial carnitine/acylcarnitine carrier protein, solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 | |
Rabbit | |
Affinity Purified | |
RUO | |
788 | |
Human, Mouse | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
SLC25A20 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:TVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYR | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction