Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC25A20 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
$416.50 - $682.00
Specifications
Antigen | SLC25A20 |
---|---|
Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SLC25A20 Polyclonal specifically detects SLC25A20 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
SLC25A20 | |
Polyclonal | |
Rabbit | |
Human, Mouse | |
CACCarnitine/acylcarnitine translocase, CACTSolute carrier family 25 member 20, mitochondrial carnitine/acylcarnitine carrier protein, solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 | |
SLC25A20 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
788 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:TVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYR | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title