Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC25A21 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15958120UL
Description
SLC25A21 Polyclonal specifically detects SLC25A21 in Human samples. It is validated for Western Blot.Specifications
SLC25A21 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
Q9BQT8 | |
SLC25A21 | |
Synthetic peptides corresponding to SLC25A21(solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21) The peptide sequence was selected from the N terminal of SLC25A21. Peptide sequence FYKGILPPILAETPKRAVKFFTFEQYKKLLGY | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
MGC126570, ODC1, ODCmitochondrial 2-oxodicarboxylate carrier, oxodicarboxylate carrier, solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21, Solute carrier family 25 member 21 | |
Rabbit | |
Affinity Purified | |
RUO | |
89874 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction