Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC25A24 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP160063
Description
SLC25A24 Polyclonal specifically detects SLC25A24 in Human samples. It is validated for Western Blot.Specifications
| SLC25A24 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| SLC25A24 | |
| Synthetic peptides corresponding to SLC25A24(solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24) The peptide sequence was selected from the middle region of SLC25A24. Peptide sequence FLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLA The peptide sequence for this immunogen was taken from within the described region. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Equine: 100%; Rat: 100%; Chicken: 85%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| Purified |
| Western Blot | |
| 1 mg/ml | |
| Western Blot 1.0 ug/ml | |
| APC1calcium-binding mitochondrial carrier protein SCaMC-1, calcium-binding transporter, DKFZp586G0123, MCSC1, Mitochondrial ATP-Mg/Pi carrier protein 1, mitochondrial ATP-Mg/Pi transporter, Mitochondrial Ca(2+)-dependent solute carrier protein 1, SCAMC1, SCAMC-1, short calcium-binding mitochondrial carrier 1, Small calcium-binding mitochondrial carrier protein 1, solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24, Solute carrier family 25 member 24 | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| 29957 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction