Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SLC25A25 Antibody, Novus Biologicals™

SLC25A25 Antibody, Novus Biologicals™
SDP

Catalog No. NBP182886 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP182886 0.1 mL
NB407003 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP182886 Supplier Novus Biologicals Supplier No. NBP182886
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

SLC25A25 Polyclonal specifically detects SLC25A25 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen SLC25A25
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20-1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias APC3, calcium-binding mitochondrial carrier protein SCaMC-2, KIAA1896RP11-395P17.4, MCSC, MCSC3, MGC105138, MGC119514, MGC119515, MGC119516, MGC119517, Mitochondrial ATP-Mg/Pi carrier protein 3, Mitochondrial Ca(2+)-dependent solute carrier protein 3, mitochondrial Ca2+-dependent solute carrier, PCSCL, SCAMC2, SCAMC-2, short calcium-binding mitochondrial carrier 2, small calcium-binding mitochondrial carrier 2, Small calcium-binding mitochondrial carrier protein 2, solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25, Solute carrier family 25 member 25, solute carrier family 25, member 25
Gene Symbols SLC25A25
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LRLVFKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAEKILKSMDKNGTMTIDWNEWRDYHLLHPVENIPEIILYWKHSTIFDVGENLT
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 114789
Test Specificity Specificity of human SLC25A25 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.