SLC25A25 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159870

Catalog No. NBP159870

Description

SLC25A25 Polyclonal specifically detects SLC25A25 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SLC25A25
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: APC3, calcium-binding mitochondrial carrier protein SCaMC-2, KIAA1896RP11-395P17.4, MCSC, MCSC3, MGC105138, MGC119514, MGC119515, MGC119516, MGC119517, Mitochondrial ATP-Mg/Pi carrier protein 3, Mitochondrial Ca(2+)-dependent solute carrier protein 3, mitochondrial Ca2+-dependent solute carrier, PCSCL, SCAMC2, SCAMC-2, short calcium-binding mitochondrial carrier 2, small calcium-binding mitochondrial carrier 2, Small calcium-binding mitochondrial carrier protein 2, solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25, Solute carrier family 25 member 25, solute carrier family 25, member 25
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 114789
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q6KCM6
• Gene Symbols: SLC25A25
• Immunogen: Synthetic peptides corresponding to SLC25A25(solute carrier family 25 (mitochondrial carrier, phosphate carrier, member 25). The peptide sequence was selected from the N-terminal of SLC25A25. Peptide sequence AVGLRRLGLHRTEGELQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLV The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

For Research Use Only