SLC25A28 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15956720UL

Catalog No. NBP15956720

Description

SLC25A28 Polyclonal specifically detects SLC25A28 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SLC25A28
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: Q96A46
• Gene Symbols: SLC25A28
• Immunogen: Synthetic peptides corresponding to SLC25A28(solute carrier family 25, member 28) The peptide sequence was selected from the middle region of SLC25A28. Peptide sequence VWQNEGAGAFYRSYTTQLTMNVPFQAIHFMTYEFLQEHFNPQRRYNPSSH.
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp547C109, hMRS3/4, MFRN2, Mitochondrial iron transporter 2, Mitochondrial RNA-splicing protein 3/4 homolog, mitoferrin-2, MRS3/4MRS4Lmitochondrial RNA splicing protein 3/4, NPD016, putative mitochondrial solute carrier, Solute carrier family 25 member 28, solute carrier family 25, member 28
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 81894
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.